Structure of PDB 3add Chain B Binding Site BS01

Receptor Information
>3add Chain B (length=239) Species: 243232 (Methanocaldococcus jannaschii DSM 2661) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKE
KYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYA
IIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLII
DTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDK
DKIKEVVELRKEFLKKIKKMEEVDADRVLKEFKDLLNSY
Ligand information
>3add Chain D (length=88) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggccgccgccaccggggugguccccgggccggacuagauccggcgcgccc
cgaguggggcgcgggguucaauuccccgcggcggccgc
<<<<<<<<<..<<<<<<....>>>>>><<<<<<.....>>>>>><<<<<<
<....>>>>>>><<<<.......>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3add Structural Basis for the Major Role of O-Phosphoseryl-tRNA Kinase in the UGA-Specific Encoding of Selenocysteine
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K55 Y79 N80 S81 M82 R84 D133 K137 K138 Y139 K140 W141 K192 R195 S199 I202 I212 R219 K220
Binding residue
(residue number reindexed from 1)		K57 Y81 N82 S83 M84 R86 D135 K139 K140 Y141 K142 W143 K183 R186 S190 I193 I203 R210 K211
Enzymatic activity
Enzyme Commision number 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0016773 phosphotransferase activity, alcohol group as acceptor
GO:0043915 L-seryl-tRNA(Sec) kinase activity
Biological Process
GO:0001717 conversion of seryl-tRNAsec to selenocys-tRNAsec
GO:0002098 tRNA wobble uridine modification
GO:0016310 phosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3add, PDBe:3add, PDBj:3add
PDBsum3add
PubMed20705242
UniProtQ58933|PSTK_METJA L-seryl-tRNA(Sec) kinase (Gene Name=pstK)

[Back to BioLiP]