Structure of PDB 3aaf Chain B Binding Site BS01

Receptor Information
>3aaf Chain B (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWDFGPQAFKLLSAVDILGEKFGIGLPILFLRGSNSQRLADQYRRHSLFG
TGKDQTESWWKAFSRQLITEGFLVEVSRYNKFMKICALTKKGRNWLHKAN
TESQSLILQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3aaf Structural basis for DNA strand separation by the unconventional winged-helix domain of RecQ helicase WRN
Resolution1.9 Å
Binding residue
(original residue number in PDB)		R987 S989 N990 S991 Q992 K1036 F1037
Binding residue
(residue number reindexed from 1)		R32 S34 N35 S36 Q37 K81 F82
Binding affinityPDBbind-CN: Kd=253nM
Enzymatic activity
Enzyme Commision number 3.1.-.-
5.6.2.4: DNA 3'-5' helicase.
Gene Ontology
Molecular Function
GO:0043138 3'-5' DNA helicase activity
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3aaf, PDBe:3aaf, PDBj:3aaf
PDBsum3aaf
PubMed20159463
UniProtQ14191|WRN_HUMAN Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (Gene Name=WRN)

[Back to BioLiP]