Structure of PDB 3aa0 Chain B Binding Site BS01

Receptor Information
>3aa0 Chain B (length=243) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIAR
DKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEAN
NAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSI
HVVEVQEKSSGRTAHYKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDE
TVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3aa0 Two distinct mechanisms for actin capping protein regulation--steric and allosteric inhibition
Resolution1.7 Å
Binding residue
(original residue number in PDB)		D3 D7 L10 D11 R14 E37 S42 D44 D63 Y64 R66 D67 G68 D69 L83 D85 G86 A87 W122 V153 T170 T194 Q196
Binding residue
(residue number reindexed from 1)		D2 D6 L9 D10 R13 E36 S41 D43 D62 Y63 R65 D66 G67 D68 L82 D84 G85 A86 W121 V152 T169 T193 Q195
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030036 actin cytoskeleton organization
GO:0051016 barbed-end actin filament capping
Cellular Component
GO:0005737 cytoplasm
GO:0008290 F-actin capping protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3aa0, PDBe:3aa0, PDBj:3aa0
PDBsum3aa0
PubMed20625546
UniProtP14315|CAPZB_CHICK F-actin-capping protein subunit beta isoforms 1 and 2 (Gene Name=CAPZB)

[Back to BioLiP]