Structure of PDB 3a5t Chain B Binding Site BS01

Receptor Information
>3a5t Chain B (length=93) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCR
VKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3a5t Structural Basis of Alternative DNA Recognition by Maf Transcription Factors
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R62 R69
Binding residue
(residue number reindexed from 1)		R43 R50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3a5t, PDBe:3a5t, PDBj:3a5t
PDBsum3a5t
PubMed19797082
UniProtO54790|MAFG_MOUSE Transcription factor MafG (Gene Name=Mafg)

[Back to BioLiP]