Structure of PDB 2zne Chain B Binding Site BS01

Receptor Information
>2zne Chain B (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDR
ENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGY
RLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDG
WIQVSYEQYLSMVFSIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zne Structural Basis for Ca(2+)-Dependent Formation of ALG-2/Alix Peptide Complex: Ca(2+)/EF3-Driven Arginine Switch Mechanism
Resolution2.2 Å
Binding residue
(original residue number in PDB)		M71 Y91 W95 V98 Y102 R104 Q117 F122 Q159 R160
Binding residue
(residue number reindexed from 1)		M47 Y67 W71 V74 Y78 R80 Q93 F98 Q135 R136
Enzymatic activity
Catalytic site (original residue number in PDB) F85 G108 I110
Catalytic site (residue number reindexed from 1) F61 G84 I86
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:2zne, PDBe:2zne, PDBj:2zne
PDBsum2zne
PubMed18940611
UniProtO75340|PDCD6_HUMAN Programmed cell death protein 6 (Gene Name=PDCD6)

[Back to BioLiP]