Structure of PDB 2zko Chain B Binding Site BS01

Receptor Information
>2zko Chain B (length=70) Species: 11320 (Influenza A virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDPNTVSSFQVDCFLWHVRKRVADQELGDAPFLDRLRRDQKSLRGRGSTL
GLDIETATRAGKQIVERILK
Ligand information
>2zko Chain C (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agacagcauuaugcugucuuu
.....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zko Structural basis for dsRNA recognition by NS1 protein of influenza A virus
Resolution1.7 Å
Binding residue
(original residue number in PDB)		A30 P31 R38 S42 G45 R46 T49
Binding residue
(residue number reindexed from 1)		A30 P31 R38 S42 G45 R46 T49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2zko, PDBe:2zko, PDBj:2zko
PDBsum2zko
PubMed18813227
UniProtP03496|NS1_I34A1 Non-structural protein 1 (Gene Name=NS)

[Back to BioLiP]