Structure of PDB 2zi0 Chain B Binding Site BS01

Receptor Information
>2zi0 Chain B (length=55) Species: 12315 (Tomato aspermy virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IEIPLHEIIRKLERMNQKKQAQRKRHKLNRKERGHKSPSEQRRSELWHAR
QVELS
Ligand information
>2zi0 Chain C (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agacagcauuaugcugucuu
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zi0 Structural basis for RNA-silencing suppression by Tomato aspermy virus protein 2b
Resolution2.82 Å
Binding residue
(original residue number in PDB)		R26 K34 K39 R46 W50 H51
Binding residue
(residue number reindexed from 1)		R23 K31 K36 R43 W47 H48
Binding affinityPDBbind-CN: Kd=75nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2zi0, PDBe:2zi0, PDBj:2zi0
PDBsum2zi0
PubMed18600235
UniProtQ8UYT3|2B_TAV Suppressor of silencing 2b (Gene Name=ORF2b)

[Back to BioLiP]