Structure of PDB 2z3x Chain B Binding Site BS01

Receptor Information
>2z3x Chain B (length=56) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLLIPQAASAIEQMKLEIASEFGVQLGAETTSRANGSVGGEITKRLVRL
AQQNMG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z3x Structure of a protein-DNA complex essential for DNA protection in spores of Bacillus species.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		S34 R35 G38 S39 G42
Binding residue
(residue number reindexed from 1)		S33 R34 G37 S38 G41
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003690 double-stranded DNA binding
Biological Process
GO:0006265 DNA topological change

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2z3x, PDBe:2z3x, PDBj:2z3x
PDBsum2z3x
PubMed18287075
UniProtP02958|SSPC_BACSU Small, acid-soluble spore protein C (Gene Name=sspC)

[Back to BioLiP]