Structure of PDB 2z3n Chain B Binding Site BS01

Receptor Information
>2z3n Chain B (length=230) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RLVQLSRHSIAFPSPEGALREPNGLLALGGDLSPARLLMAYQRGIFPWFS
PGDPILWWSPDPRAVLWPESLHISRSMKRFHKRSPYRVTMNYAFGQVIEG
CASDREGTWITRGVVEAYHRLHELGHAHSIEVWREDELVGGMYGVAQGTL
FCGESMFSRMENASKTALLVFCEEFIGHGGKLIDCQVLNDHTASLGACEI
PRRDYLNYLNQMRLGRLPNNFWVPRCLFSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2z3n Protein-based peptide-bond formation by aminoacyl-tRNA protein transferase
Resolution2.5 Å
Binding residue
(original residue number in PDB)
F47 P48 W49 W111 I112 M144 G155 E156 S157 M158 C187 Q188
Binding residue
(residue number reindexed from 1)
F46 P47 W48 W109 I110 M142 G153 E154 S155 M156 C185 Q186
Enzymatic activity
Enzyme Commision number 2.3.2.6: lysine/arginine leucyltransferase.
Gene Ontology
Molecular Function
GO:0008914 leucyl-tRNA--protein transferase activity
GO:0016746 acyltransferase activity
GO:0016755 aminoacyltransferase activity
Biological Process
GO:0030163 protein catabolic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2z3n, PDBe:2z3n, PDBj:2z3n
PDBsum2z3n
PubMed17891155
UniProtP0A8P1|LFTR_ECOLI Leucyl/phenylalanyl-tRNA--protein transferase (Gene Name=aat)

[Back to BioLiP]