Structure of PDB 2ypt Chain B Binding Site BS01

Receptor Information

>2ypt Chain B (length=416) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIM
DSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRPE
YEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDA
IKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYAD
YIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAY
FYGFKRIVLFDTLLEQGCKNEEVLAVLGHALGHWKLGHTVKNIIISQMNS
FLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFC
LTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWH
YSHPPLLERLQALKTM

Ligand information

>2ypt Chain G (length=4) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CSIM

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ypt The Structural Basis of Zmpste24-Dependent Laminopathies.
Resolution	3.8 Å
Binding residue (original residue number in PDB)	N265 A266 H339 H459 R465
Binding residue (residue number reindexed from 1)	N248 A249 H283 H403 R409

Enzymatic activity

Enzyme Commision number

3.4.24.84: Ste24 endopeptidase.

Gene Ontology

	Molecular Function
GO:0003690	double-stranded DNA binding
GO:0004175	endopeptidase activity
GO:0004222	metalloendopeptidase activity
GO:0005515	protein binding
GO:0008233	peptidase activity
GO:0008235	metalloexopeptidase activity
GO:0008237	metallopeptidase activity
GO:0046872	metal ion binding

	Biological Process
GO:0001889	liver development
GO:0001942	hair follicle development
GO:0003007	heart morphogenesis
GO:0003229	ventricular cardiac muscle tissue development
GO:0003231	cardiac ventricle development
GO:0003417	growth plate cartilage development
GO:0006281	DNA repair
GO:0006325	chromatin organization
GO:0006355	regulation of DNA-templated transcription
GO:0006508	proteolysis
GO:0006925	inflammatory cell apoptotic process
GO:0006974	DNA damage response
GO:0006997	nucleus organization
GO:0006998	nuclear envelope organization
GO:0007346	regulation of mitotic cell cycle
GO:0007628	adult walking behavior
GO:0008016	regulation of heart contraction
GO:0008340	determination of adult lifespan
GO:0008360	regulation of cell shape
GO:0008544	epidermis development
GO:0010506	regulation of autophagy
GO:0010628	positive regulation of gene expression
GO:0010629	negative regulation of gene expression
GO:0010906	regulation of glucose metabolic process
GO:0016485	protein processing
GO:0019216	regulation of lipid metabolic process
GO:0030282	bone mineralization
GO:0030327	prenylated protein catabolic process
GO:0030500	regulation of bone mineralization
GO:0032006	regulation of TOR signaling
GO:0032350	regulation of hormone metabolic process
GO:0035264	multicellular organism growth
GO:0040014	regulation of multicellular organism growth
GO:0040029	epigenetic regulation of gene expression
GO:0043007	maintenance of rDNA
GO:0043516	regulation of DNA damage response, signal transduction by p53 class mediator
GO:0044029	positive regulation of gene expression via chromosomal CpG island demethylation
GO:0044255	cellular lipid metabolic process
GO:0048145	regulation of fibroblast proliferation
GO:0048538	thymus development
GO:0050688	regulation of defense response to virus
GO:0050905	neuromuscular process
GO:0051276	chromosome organization
GO:0051604	protein maturation
GO:0055013	cardiac muscle cell development
GO:0060307	regulation of ventricular cardiac muscle cell membrane repolarization
GO:0060993	kidney morphogenesis
GO:0061337	cardiac conduction
GO:0061762	CAMKK-AMPK signaling cascade
GO:0070302	regulation of stress-activated protein kinase signaling cascade
GO:0071480	cellular response to gamma radiation
GO:0071586	CAAX-box protein processing
GO:0072423	response to DNA damage checkpoint signaling
GO:1903463	regulation of mitotic cell cycle DNA replication
GO:1903522	regulation of blood circulation
GO:1903799	negative regulation of miRNA processing
GO:1990036	calcium ion import into sarcoplasmic reticulum
GO:2000730	regulation of termination of RNA polymerase I transcription
GO:2000772	regulation of cellular senescence

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005637	nuclear inner membrane
GO:0005768	endosome
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0016020	membrane
GO:0031901	early endosome membrane
GO:0031902	late endosome membrane
GO:0032991	protein-containing complex
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2ypt, PDBe:2ypt, PDBj:2ypt
PDBsum	2ypt
PubMed	23539603
UniProt	O75844\|FACE1_HUMAN CAAX prenyl protease 1 homolog (Gene Name=ZMPSTE24)

[Back to BioLiP]