Structure of PDB 2ypb Chain B Binding Site BS01

Receptor Information
>2ypb Chain B (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLEEKDLRDRERRMANNARERVRVRDINEAFRELGRMCQMHLKSDKAQTK
LLILQQAVQVILGLEQQVRERNLN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ypb Structural Basis for Lmo2-Driven Recruitment of the Scl:E47bHLH Heterodimer to Hematopoietic-Specific Transcriptional Targets.
Resolution2.87 Å
Binding residue
(original residue number in PDB)		R548 N552 R556 N563 T584 K585
Binding residue
(residue number reindexed from 1)		R13 N17 R21 N28 T49 K50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:2ypb, PDBe:2ypb, PDBj:2ypb
PDBsum2ypb
PubMed23831025
UniProtP15923|TFE2_HUMAN Transcription factor E2-alpha (Gene Name=TCF3)

[Back to BioLiP]