Structure of PDB 2yjd Chain B Binding Site BS01

Receptor Information
>2yjd Chain B (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISW
AKKIPGFVELSLFDQVRLLESCWMEVLMMGLMWRSIDHPGKLIFAPDLVL
DRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSSSR
KLAHLLNAVTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGME
HLLNMKCKNVVPVYDLLLEMLNA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yjd Design and Structure of Stapled Peptides Binding to Estrogen Receptors.
Resolution1.93 Å
Binding residue
(original residue number in PDB)		I310 K314 L324 V328 L490 E493
Binding residue
(residue number reindexed from 1)		I48 K52 L62 V66 L216 E219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2yjd, PDBe:2yjd, PDBj:2yjd
PDBsum2yjd
PubMed21612236
UniProtQ92731|ESR2_HUMAN Estrogen receptor beta (Gene Name=ESR2)

[Back to BioLiP]