Structure of PDB 2yhm Chain B Binding Site BS01

Receptor Information
>2yhm Chain B (length=375) Species: 11250 (human respiratory syncytial virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGM
LLITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTH
RQDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYR
HDSPDCGMIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGL
LPKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNA
YGAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGF
YHILNNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAA
KAYAEQLKENGVINYSVLDLTAEEL
Ligand information
>2yhm Chain K (length=70) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccc
..................................................
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2yhm Structures of Respiratory Syncytial Virus Nucleocapsid Protein from Two Crystal Forms: Details of Potential Packing Interactions in the Native Helical Form.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		K170 A172 R184 R185 V189 I242 G254 V256 W260 S313 T315 G335 Y337 R338
Binding residue
(residue number reindexed from 1)		K170 A172 R184 R185 V189 I242 G254 V256 W260 S313 T315 G335 Y337 R338
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030291 protein serine/threonine kinase inhibitor activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
GO:0039580 symbiont-mediated suppression of host PKR/eIFalpha signaling
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2yhm, PDBe:2yhm, PDBj:2yhm
PDBsum2yhm
PubMed22102022
UniProtP03418|NCAP_HRSVA Nucleoprotein (Gene Name=N)

[Back to BioLiP]