Structure of PDB 2xze Chain B Binding Site BS01

Receptor Information
>2xze Chain B (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDHGDVSLPPEDRVRALSQLGSAVEVNEDIPPRRYFRSGVEIIRMASIYS
EEGNIEHAFILYNKYITLFIEKLPKHRDYKSAVIPEKKDTVKKLKEIAFP
KAEELKAELLKRYTKEYTEYNEEKKKEAEELARNMAIQ
Ligand information
>2xze Chain R (length=20) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEEEEEALEAMQSRLATLRS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xze Structural Basis for Escrt-III Chmp3 Recruitment of Amsh.
Resolution1.75 Å
Binding residue
(original residue number in PDB)
R16 S23 N64 I67 T68 I71 E72 Y80 K88 K89 V92 L95 F100 E104 K107
Binding residue
(residue number reindexed from 1)
R15 S22 N63 I66 T67 I70 E71 Y79 K87 K88 V91 L94 F99 E103 K106
Enzymatic activity
Enzyme Commision number 3.4.19.-
External links
PDB RCSB:2xze, PDBe:2xze, PDBj:2xze
PDBsum2xze
PubMed21827950
UniProtO95630|STABP_HUMAN STAM-binding protein (Gene Name=STAMBP)

[Back to BioLiP]