Structure of PDB 2xs5 Chain B Binding Site BS01

Receptor Information
>2xs5 Chain B (length=83) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYG
FVSFYNDVDVQKIVESQINFHGKKLKLGPAIRK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xs5 Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R57 K67 Y88 K116
Binding residue
(residue number reindexed from 1)		R24 K34 Y55 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding

View graph for
Molecular Function
External links
PDB RCSB:2xs5, PDBe:2xs5, PDBj:2xs5
PDBsum2xs5
PubMed22021443
UniProtQ64368|DAZL_MOUSE Deleted in azoospermia-like (Gene Name=Dazl)

[Back to BioLiP]