Structure of PDB 2xro Chain B Binding Site BS01

Receptor Information
>2xro Chain B (length=240) Species: 303 (Pseudomonas putida) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQVIARAASIMRALGSHPHGLSLAAIAQLVGLPRSTVQRIINALEEEFLV
EALGPAGGFRLGPALGQLINQAQTDILSLVKPYLRSLAEELDESVSLASL
AGDKIYVLDRIVSERELRVVFPIGINVPAAATAAGKVLLAALPDETLQAA
LGEQLPVLTSNTLGRKALVKQLSEVRQSGVASDLDEHIDGVSSFATLLDT
YLGYYSLAIVMPSSRASKQSDLIKKALLQSKLNIERAIGR
Ligand information
>2xro Chain X (length=42) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gagtatcacataatgctacactctaccgcattacgattcagc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xro Crystal Structure of Ttgv in Complex with its DNA Operator Reveals a General Model for Cooperative DNA Binding of Tetrameric Gene Regulators.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		Q15 S35 L36 A37 Q51 F72
Binding residue
(residue number reindexed from 1)		Q2 S22 L23 A24 Q38 F59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xro, PDBe:2xro, PDBj:2xro
PDBsum2xro
PubMed21078819
UniProtQ93PU6|TTGV_PSEPT HTH-type transcriptional regulator TtgV (Gene Name=ttgV)

[Back to BioLiP]