Structure of PDB 2xdd Chain B Binding Site BS01

Receptor Information
>2xdd Chain B (length=162) Species: 29471 (Pectobacterium atrosepticum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFYTISSKYIEYLKEFDDKVPNSEDPTYQNPKAFIGIVLEIQGHKYLAP
LTSPKKWHNNVKESSLSCFKLHENGVPENQLGLINLKFMIPIIEAEVSLL
DLGNMPNTPYKRMLYKQLQFIRANSDKIASKSDTLRNLVLQGKMQGTCNF
SLLEEKYRDFGK
Ligand information
>2xdd Chain F (length=36) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
auucaggugauuugcuaccuuuaagugcagcuagaa
....<<<<...((((.>>>>......))))......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xdd The Phage Abortive Infection System, Toxin, Functions as a Protein-RNA Toxin-Antitoxin Pair.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K2 F3 Y29 Q30 N31 K33 T52 S53 P54 K55 E73 N79 Q80 L81 G82 L100 L102 P109 Y110 M113 Y115 K116 Q117 L118 Q119 R122 A123
Binding residue
(residue number reindexed from 1)		K2 F3 Y29 Q30 N31 K33 T52 S53 P54 K55 E73 N79 Q80 L81 G82 L100 L102 P109 Y110 M113 Y115 K116 Q117 L118 Q119 R122 A123
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004521 RNA endonuclease activity
GO:0042802 identical protein binding
Biological Process
GO:0006276 plasmid maintenance
GO:0045892 negative regulation of DNA-templated transcription
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xdd, PDBe:2xdd, PDBj:2xdd
PDBsum2xdd
PubMed19124776
UniProtB8X8Z0|TOXN_PECAT Endoribonuclease ToxN (Gene Name=toxN)

[Back to BioLiP]