Structure of PDB 2xcf Chain B Binding Site BS01

Receptor Information
>2xcf Chain B (length=153) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTN
VDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLL
SPRPISYLKGSAGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLET
TMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xcf Synthesis and Evaluation of Novel Alpha-Amino Cyclic Boronates as Inhibitors of Hcv Ns3 Protease.
Resolution2.48 Å
Binding residue
(original residue number in PDB)		V29 E30 G31 E32 V33 I35 V36 S37 R62 T63 I64 W85 P88 G90
Binding residue
(residue number reindexed from 1)		V2 E3 G4 E5 V6 I8 V9 S10 R35 T36 I37 W58 P61 G63
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D81 G137 A139
Catalytic site (residue number reindexed from 1) H30 D54 G110 A112
Enzyme Commision number 3.6.4.13: RNA helicase.
Gene Ontology
Molecular Function
GO:0008233 peptidase activity
GO:0008236 serine-type peptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
GO:0019062 virion attachment to host cell
GO:0019087 transformation of host cell by virus
GO:0046718 symbiont entry into host cell
Cellular Component
GO:0016020 membrane
GO:0033644 host cell membrane
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xcf, PDBe:2xcf, PDBj:2xcf
PDBsum2xcf
PubMed20493689
UniProtC1KHN2

[Back to BioLiP]