Structure of PDB 2xc8 Chain B Binding Site BS01

Receptor Information
>2xc8 Chain B (length=127) Species: 10724 (Bacillus phage SPP1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIEIVNRKAVWYLTSEIKETETGIEVSAGELHKGDEEVFPVEEVSFDLTP
DDTYPVEYMLYLHMNVQTKKVSWSLCKAYLDGEGYCDYQGNERLIMYPVS
VTVFPNGTREGTIFLYEKEDKPPVIVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xc8 Crystal Structure of Bacillus Subtilis Spp1 Phage Gp22 Shares Fold Similarity with a Domain of Lactococcal Phage P2 Rbp.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		V44 S74 L75 C76 K77 E83 Y85 Q89
Binding residue
(residue number reindexed from 1)		V44 S74 L75 C76 K77 E83 Y85 Q89
Enzymatic activity
Enzyme Commision number ?
External links