Structure of PDB 2x7n Chain B Binding Site BS01

Receptor Information
>2x7n Chain B (length=224) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVH
TTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEER
LSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGS
YCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVN
DYLAVTGLDTTAPELSVIESIFRL
Ligand information
>2x7n Chain A (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
accguauaguacgagaggaacuacgguu
<<<<<<...............>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x7n Mechanism of Eif6-Mediated Inhibition of Ribosomal Subunit Joining.
Resolution11.8 Å
Binding residue
(original residue number in PDB)		S31 N33
Binding residue
(residue number reindexed from 1)		S31 N33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0043022 ribosome binding
GO:0043023 ribosomal large subunit binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000470 maturation of LSU-rRNA
GO:0006364 rRNA processing
GO:0006412 translation
GO:0006413 translational initiation
GO:0042254 ribosome biogenesis
GO:0042256 cytosolic ribosome assembly
GO:0042273 ribosomal large subunit biogenesis
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0030687 preribosome, large subunit precursor

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2x7n, PDBe:2x7n, PDBj:2x7n
PDBsum2x7n
PubMed20356839
UniProtQ12522|IF6_YEAST Eukaryotic translation initiation factor 6 (Gene Name=TIF6)

[Back to BioLiP]