Structure of PDB 2wt7 Chain B Binding Site BS01

Receptor Information
>2wt7 Chain B (length=90) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQK
HHLENEKTQLIQQVEQLKQEVSRLARERDAYKVKSEKLAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wt7 Design of a bZIP Transcription Factor with Homo/Heterodimer-Induced DNA-Binding Preference.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		V221 K240 R243 R244 Y251 A252 C255 R259
Binding residue
(residue number reindexed from 1)		V8 K27 R30 R31 Y38 A39 C42 R46
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wt7, PDBe:2wt7, PDBj:2wt7
PDBsum2wt7
PubMed24530283
UniProtP54841|MAFB_MOUSE Transcription factor MafB (Gene Name=Mafb)

[Back to BioLiP]