Structure of PDB 2wp2 Chain B Binding Site BS01

Receptor Information
>2wp2 Chain B (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTNQLQFLQRVVLKALWKHGFSWPFQQPVDAVKLKLPDYYTIIKTPMDLN
TIKKRLENKYYEKASECIEDFNTMFSNCYLYNKTGDDIVVMAQALEKLFM
QKLSQMPQEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wp2 Cooperative Binding of Two Acetylation Marks on a Histone Tail by a Single Bromodomain.
Resolution2.37 Å
Binding residue
(original residue number in PDB)
W49 V55 P63 D64 Y107 N108 D113 I114 M117
Binding residue
(residue number reindexed from 1)
W23 V29 P37 D38 Y81 N82 D87 I88 M91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wp2, PDBe:2wp2, PDBj:2wp2
PDBsum2wp2
PubMed19794495
UniProtQ91Y44|BRDT_MOUSE Bromodomain testis-specific protein (Gene Name=Brdt)

[Back to BioLiP]