Structure of PDB 2wp1 Chain B Binding Site BS01

Receptor Information
>2wp1 Chain B (length=112) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVKVTEQLKHCSEILKEMLAKKHLPYAWPFYNPVDADALGLHNYYDVVKN
PMDLGTIKGKMDNQEYKDAYEFAADVRLMFMNCYKYNPPDHEVVAMARTL
QDVFELHFAKIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wp1 Cooperative Binding of Two Acetylation Marks on a Histone Tail by a Single Bromodomain.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
I375 P376
Binding residue
(residue number reindexed from 1)
I111 P112
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2wp1, PDBe:2wp1, PDBj:2wp1
PDBsum2wp1
PubMed19794495
UniProtQ91Y44|BRDT_MOUSE Bromodomain testis-specific protein (Gene Name=Brdt)

[Back to BioLiP]