Structure of PDB 2w7n Chain B Binding Site BS01

Receptor Information
>2w7n Chain B (length=95) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVS
QAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w7n Crystal Structure of Kora Bound to Operator DNA: Insight Into Repressor Cooperation in Rp4 Gene Regulation
Resolution1.85 Å
Binding residue
(original residue number in PDB)
P36 Q37 A38 R48 G49 S52 Q53
Binding residue
(residue number reindexed from 1)
P34 Q35 A36 R46 G47 S50 Q51
Binding affinityPDBbind-CN: Kd=23.3nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding

View graph for
Molecular Function
External links
PDB RCSB:2w7n, PDBe:2w7n, PDBj:2w7n
PDBsum2w7n
PubMed19190096
UniProtP03052|KORA2_ECOLX TrfB transcriptional repressor protein (Gene Name=trfB)

[Back to BioLiP]