Structure of PDB 2w36 Chain B Binding Site BS01

Receptor Information
>2w36 Chain B (length=223) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDYRQLHRWDLPPEEAIKVQNELRKKIKLTPYEGEPEYVAGVALSFPGKE
EGLAVIVVLEYPSFKILEVVSERGEITFPYIPGLLAFREGPLFLKAWEKL
RTKPDVVVFDGQGLAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTFKMPE
DKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFT
LPGRRIPEPTRLAHIYTQRLKKG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w36 Structures of Endonuclease V with DNA Reveal Initiation of Deaminated Adenine Repair.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		L44 S45 F46 Y80 P82 G83 L85 Q112 H116 G121 I122 A138 K139 S140 R141 L142 Q218 K221
Binding residue
(residue number reindexed from 1)		L44 S45 F46 Y80 P82 G83 L85 Q112 H116 G121 I122 A138 K139 S140 R141 L142 Q218 K221
Enzymatic activity
Enzyme Commision number 3.1.21.7: deoxyribonuclease V.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003727 single-stranded RNA binding
GO:0004519 endonuclease activity
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0043737 deoxyribonuclease V activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2w36, PDBe:2w36, PDBj:2w36
PDBsum2w36
PubMed19136958
UniProtQ9X2H9|NFI_THEMA Endonuclease V (Gene Name=nfi)

[Back to BioLiP]