Structure of PDB 2w10 Chain B Binding Site BS01

Receptor Information
>2w10 Chain B (length=62) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLG
LFPANYVAPMMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w10 Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y12 F14 E15 L17 D20 E21 S39 W40 L51 P53 Y56
Binding residue
(residue number reindexed from 1)		Y12 F14 E15 L17 D20 E21 S39 W40 L51 P53 Y56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2w10, PDBe:2w10, PDBj:2w10
PDBsum2w10
PubMed19523899
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]