Structure of PDB 2w0p Chain B Binding Site BS01

Receptor Information
>2w0p Chain B (length=94) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEISF
EDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w0p Structural Basis of the Migfilin-Filamin Interaction and Competition with Integrin {Beta} Tails.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		G2270 L2271 A2272 I2273 A2274 V2275 E2276 G2277 K2280 F2285
Binding residue
(residue number reindexed from 1)		G35 L36 A37 I38 A39 V40 E41 G42 K45 F50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0051015 actin filament binding
Biological Process
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2w0p, PDBe:2w0p, PDBj:2w0p
PDBsum2w0p
PubMed18829455
UniProtP21333|FLNA_HUMAN Filamin-A (Gene Name=FLNA)

[Back to BioLiP]