Structure of PDB 2vzg Chain B Binding Site BS01

Receptor Information
>2vzg Chain B (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYL
VLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRP
EDIVNCDLKSTLRVLYNLFTKYRNVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vzg Structural analysis of the interactions between paxillin LD motifs and alpha-parvin.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K260 V264 T267 Y362 R369
Binding residue
(residue number reindexed from 1)		K14 V18 T21 Y116 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0007155 cell adhesion
GO:0030036 actin cytoskeleton organization

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2vzg, PDBe:2vzg, PDBj:2vzg
PDBsum2vzg
PubMed18940607
UniProtQ9NVD7|PARVA_HUMAN Alpha-parvin (Gene Name=PARVA)

[Back to BioLiP]