Structure of PDB 2vt1 Chain B Binding Site BS01

Receptor Information
>2vt1 Chain B (length=81) Species: 623 (Shigella flexneri) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTHIAIGIYFNPEIAPAPFISLIETNQCALAVRKYANEVGIPTVRDVKLA
RKLYKTHTKYSFVDFEHLDEVLRLIVWLEQV
Ligand information
>2vt1 Chain A (length=21) Species: 623 (Shigella flexneri) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IEILSEQTKSDIRNSKLVVMN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vt1 Crystal Structure of Spa40, the Specificity Switch for the Shigella Flexneri Type III Secretion System
Resolution2.0 Å
Binding residue
(original residue number in PDB)		I261 A262 I263 I265 S278 A288 R290 Y292 A293 I298 P299 T300 V301 R302 D303 A307 Y317
Binding residue
(residue number reindexed from 1)		I4 A5 I6 I8 S21 A31 R33 Y35 A36 I41 P42 T43 V44 R45 D46 A50 Y60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vt1, PDBe:2vt1, PDBj:2vt1
PDBsum2vt1
PubMed18485071
UniProtP0A1M8|SPAS_SHIFL Surface presentation of antigens protein SpaS (Gene Name=spaS)

[Back to BioLiP]