Structure of PDB 2voo Chain B Binding Site BS01

Receptor Information
>2voo Chain B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRL
NRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDV
KNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVF
DSIESAKKFVETPGQKYKETDLLILFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2voo Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
Q20 Y23 Y24 D33 F35 F55 N56 R57 L124 N139 I140
Binding residue
(residue number reindexed from 1)
Q12 Y15 Y16 D25 F27 F47 N48 R49 L116 N131 I132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2voo, PDBe:2voo, PDBj:2voo
PDBsum2voo
PubMed18547518
UniProtP05455|LA_HUMAN Lupus La protein (Gene Name=SSB)

[Back to BioLiP]