Structure of PDB 2von Chain B Binding Site BS01

Receptor Information
>2von Chain B (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFN
RLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKN
DVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFV
VFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2von Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Q20 Y23 Y24 D33 K34 F35 K54 F55 N56 R57 L124 N139 I140
Binding residue
(residue number reindexed from 1)		Q14 Y17 Y18 D27 K28 F29 K48 F49 N50 R51 L118 N133 I134
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2von, PDBe:2von, PDBj:2von
PDBsum2von
PubMed18547518
UniProtP05455|LA_HUMAN Lupus La protein (Gene Name=SSB)

[Back to BioLiP]