Structure of PDB 2vod Chain B Binding Site BS01

Receptor Information
>2vod Chain B (length=188) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIK
FNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEY
KNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSI
FVVFDSIESAKKFVETPGQKYKETDLLILFKDDYFAKK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vod Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Q20 Y23 Y24 D33 K34 F35 K54 F55 N56 R57 N139 I140
Binding residue
(residue number reindexed from 1)		Q16 Y19 Y20 D29 K30 F31 K50 F51 N52 R53 N135 I136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0006396 RNA processing
Cellular Component
GO:0005634 nucleus
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2vod, PDBe:2vod, PDBj:2vod
PDBsum2vod
PubMed18547518
UniProtP05455|LA_HUMAN Lupus La protein (Gene Name=SSB)

[Back to BioLiP]