Structure of PDB 2vju Chain B Binding Site BS01

Receptor Information

>2vju Chain B (length=135) Species: 210 (Helicobacter pylori) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SAMASNAVLYKSNHNVVYSCKYHIVWCPKYRRKVLVGAVEMRLKEIIQEV
AKELRVEIIEMQTDKDHIHILADIDPSFGVMKFIKTAKGRSSRILRQEFN
HLKTKLPTLWTNSCFISTVGGAPLNVVKQYIENQQ

Ligand information

>2vju Chain C (length=35) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaatcccctagctttagctatggggagtatgtcaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2vju Mechanism of is200/is605 Family DNA Transposases: Activation and Transposon-Directed Target Site Selection.
Resolution	2.4 Å
Binding residue (original residue number in PDB)	N10 H11 N12 V14 L51 R52 D72 S74 F75
Binding residue (residue number reindexed from 1)	N13 H14 N15 V17 L54 R55 D75 S77 F78

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004803	transposase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006313	DNA transposition

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2vju, PDBe:2vju, PDBj:2vju
PDBsum	2vju
PubMed	18243097
UniProt	Q933Z0

[Back to BioLiP]