Structure of PDB 2v3s Chain B Binding Site BS01

Receptor Information
>2v3s Chain B (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPISLVLRLRNSKKELNDIRFEFTPGRDTAEGVSQELISAGLVDGRDLVI
VAANLQKIVEEPQSNRSVTFKLASGVEGSDIPDDGKLIGFAQLSIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2v3s Structural Insights Into the Recognition of Substrates and Activators by the Osr1 Kinase
Resolution1.7 Å
Binding residue
(original residue number in PDB)		N448 D449 I450 R451 F452 D459 E467 L468 L473
Binding residue
(residue number reindexed from 1)		N17 D18 I19 R20 F21 D28 E36 L37 L42
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0004674 protein serine/threonine kinase activity
GO:0005524 ATP binding

View graph for
Molecular Function
External links
PDB RCSB:2v3s, PDBe:2v3s, PDBj:2v3s
PDBsum2v3s
PubMed17721439
UniProtO95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 (Gene Name=OXSR1)

[Back to BioLiP]