Structure of PDB 2v2t Chain B Binding Site BS01

Receptor Information

>2v2t Chain B (length=313) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNY
VGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANL
GILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLT
DREKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAI
YDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEE
NGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDL
ETSEPKPFLYYPE

Ligand information

>2v2t Chain C (length=11) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgggaattccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2v2t X-Ray Structure of a NF-kappaB p50/Relb/DNA Complex Reveals Assembly of Multiple Dimers on Tandem kappaB Sites.
Resolution	3.05 Å
Binding residue (original residue number in PDB)	R56 H64 K241
Binding residue (residue number reindexed from 1)	R19 H27 K204

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2v2t, PDBe:2v2t, PDBj:2v2t
PDBsum	2v2t
PubMed	17869269
UniProt	P25799\|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit (Gene Name=Nfkb1)

[Back to BioLiP]