Structure of PDB 2sem Chain B Binding Site BS01

Receptor Information
>2sem Chain B (length=59) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPS
NYVCPYNSN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2sem Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F263 E269 E272 W291 I302 N306 Y307
Binding residue
(residue number reindexed from 1)		F8 E14 E17 W36 I47 N51 Y52
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2sem, PDBe:2sem, PDBj:2sem
PDBsum2sem
PubMed9851931
UniProtP29355|SEM5_CAEEL Sex muscle abnormal protein 5 (Gene Name=sem-5)

[Back to BioLiP]