Structure of PDB 2seb Chain B Binding Site BS01

Receptor Information

>2seb Chain B (length=177) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVT
ELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTV
YPANLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLV
MLETVEVYTCQVEHPSLTSPLTVEWRA

Ligand information

>2seb Chain E (length=12) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AYMRADAAAGGA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2seb X-ray crystal structure of HLA-DR4 (DRA0101, DRB10401) complexed with a peptide from human collagen II.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	H13 F26 Y30 Y60 W61 K71 T77 Y78 H81 N82 V85
Binding residue (residue number reindexed from 1)	H12 F25 Y29 Y59 W60 K70 T76 Y77 H80 N81 V84

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2seb, PDBe:2seb, PDBj:2seb
PDBsum	2seb
PubMed	9354468
UniProt	P01911\|DRB1_HUMAN HLA class II histocompatibility antigen, DRB1 beta chain (Gene Name=HLA-DRB1)

[Back to BioLiP]