Structure of PDB 2ruk Chain B Binding Site BS01

Receptor Information
>2ruk Chain B (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADI
KCQKISPEGKAKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLL
PKFKRKAN
Ligand information
>2ruk Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLMLSPDDIEQWFTEDPGPDE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2ruk Extended string binding mode of the phosphorylated transactivation domain of tumor suppressor p53.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q17 K18 K19 K51 C52 Q53 K54 I55 S56 P57 K60 K62 Q64 L65 Q66 N76 K93 Q97 K104 R105 K106 A107 N108
Binding residue
(residue number reindexed from 1)		Q17 K18 K19 K51 C52 Q53 K54 I55 S56 P57 K60 K62 Q64 L65 Q66 N76 K93 Q97 K104 R105 K106 A107 N108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006351 DNA-templated transcription
Cellular Component
GO:0000439 transcription factor TFIIH core complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2ruk, PDBe:2ruk, PDBj:2ruk
PDBsum2ruk
PubMed25216154
UniProtP32780|TF2H1_HUMAN General transcription factor IIH subunit 1 (Gene Name=GTF2H1)

[Back to BioLiP]