Structure of PDB 2rqh Chain B Binding Site BS01

Receptor Information
>2rqh Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDN
SELLHMLESPESLRSKVDEAVAVLQAHQAKEAA
Ligand information
>2rqh Chain A (length=22) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AKPFVPNVHAAEFVPSFLRGPA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rqh Eukaryotic Translation Termination Factor Gspt/Erf3 Recognizes Pabp with Chemical Exchange Using Two Overlapping Motifs
ResolutionN/A
Binding residue
(original residue number in PDB)		Q560 G563 E564 K580 M584 L586 I588 E609 V613 H617
Binding residue
(residue number reindexed from 1)		Q20 G23 E24 K40 M44 L46 I48 E69 V73 H77
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2rqh, PDBe:2rqh, PDBj:2rqh
PDBsum2rqh
PubMed
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]