Structure of PDB 2rqg Chain B Binding Site BS01

Receptor Information
>2rqg Chain B (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDN
SELLHMLESPESLRSKVDEAVAVLQAHQAKEAA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rqg Eukaryotic Translation Termination Factor Gspt/Erf3 Recognizes Pabp with Chemical Exchange Using Two Overlapping Motifs
ResolutionN/A
Binding residue
(original residue number in PDB)		K559 Q560 E564 G583 M584 L586 I588 K606 E609 V613
Binding residue
(residue number reindexed from 1)		K19 Q20 E24 G43 M44 L46 I48 K66 E69 V73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2rqg, PDBe:2rqg, PDBj:2rqg
PDBsum2rqg
PubMed
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]