Structure of PDB 2rn5 Chain B Binding Site BS01

Receptor Information
>2rn5 Chain B (length=32) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKTKR
Ligand information
>2rn5 Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rn5 NMR structure of biosynthetic engineered human insulin monomer B31(Lys)-B32(Arg) in water/acetonitrile solution. Comparison with the solution structure of native human insulin monomer
ResolutionN/A
Binding residue
(original residue number in PDB)		F1 V2 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 K29 R32
Binding residue
(residue number reindexed from 1)		F1 V2 N3 Q4 H5 L6 C7 L11 V18 C19 R22 G23 F24 F25 Y26 K29 R32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2rn5, PDBe:2rn5, PDBj:2rn5
PDBsum2rn5
PubMed18491415
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]