Structure of PDB 2rf9 Chain B Binding Site BS01

Receptor Information

>2rf9 Chain B (length=269) Species: 9606 (Homo sapiens)

QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEKIPVAIKELRANKEIL
DEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIG
SQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAK
LLGEYHAGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYD
GIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELII
EFSKMARDPQRYLVIQGDE

Ligand information

>2rf9 Chain D (length=26) Species: 9606 (Homo sapiens)

SLPSYLNGVMPPTQSFAPDPKYVSSK

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2rf9 Inhibition of the EGF receptor by binding of MIG6 to an activating kinase domain interface.
• Resolution: 3.5 Å
• Binding residue (original residue number in PDB): W881 T885 E904 K905 G906 E907 R908 P910 Q911 P913 I917 V924 W927 M928
• Binding residue (residue number reindexed from 1): W189 T193 E212 K213 G214 E215 R216 P218 Q219 P221 I225 V232 W235 M236

Enzymatic activity

• Catalytic site (original residue number in PDB): D813 A815 R817 N818 D831 G850
• Catalytic site (residue number reindexed from 1): D127 A129 R131 N132 D145 G158
• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:2rf9, PDBe:2rf9, PDBj:2rf9
• PDBsum: 2rf9
• PubMed: 18046415
• UniProt: P00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)