Structure of PDB 2rbf Chain B Binding Site BS01

Receptor Information
>2rbf Chain B (length=45) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTMGVKLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLENSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2rbf Structural basis of the transcriptional regulation of the proline utilization regulon by multifunctional PutA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		G7 K9
Binding residue
(residue number reindexed from 1)		G4 K6
Binding affinityPDBbind-CN: Kd=210nM
Enzymatic activity
Enzyme Commision number 1.2.1.88: L-glutamate gamma-semialdehyde dehydrogenase.
1.5.5.2: proline dehydrogenase.
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:2rbf, PDBe:2rbf, PDBj:2rbf
PDBsum2rbf
PubMed18586269
UniProtP09546|PUTA_ECOLI Bifunctional protein PutA (Gene Name=putA)

[Back to BioLiP]