Structure of PDB 2r5z Chain B Binding Site BS01

Receptor Information

>2r5z Chain B (length=59) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGN
KRIRYKKNI

Ligand information

>2r5z Chain C (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actctaagattaatcggctg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2r5z Functional specificity of a Hox protein mediated by the recognition of minor groove structure
Resolution	2.6 Å
Binding residue (original residue number in PDB)	F208 Q244 N247 W248 N251 R255
Binding residue (residue number reindexed from 1)	F4 Q43 N46 W47 N50 R54
Binding affinity	PDBbind-CN: Kd=8.63nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677	DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2r5z, PDBe:2r5z, PDBj:2r5z
PDBsum	2r5z
PubMed	17981120
UniProt	P40427\|EXD_DROME Homeobox protein extradenticle (Gene Name=exd)

[Back to BioLiP]