Structure of PDB 2qkb Chain B Binding Site BS01

Receptor Information
>2qkb Chain B (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMGDFVVVYTDGCCSSNRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQR
AEIHAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSA
GKEVINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQS
Ligand information
>2qkb Chain C (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagugcgacaccugauucc
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qkb Structure of Human RNase H1 Complexed with an RNA/DNA Hybrid: Insight into HIV Reverse Transcription
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D145 C147 C148 N151 N182 E186 N210 M212 H260 G263 R278
Binding residue
(residue number reindexed from 1)		D12 C14 C15 N18 N48 E52 N76 M78 H126 G129 R144
Enzymatic activity
Enzyme Commision number 3.1.26.4: ribonuclease H.
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0004523 RNA-DNA hybrid ribonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:2qkb, PDBe:2qkb, PDBj:2qkb
PDBsum2qkb
PubMed17964265
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]