Structure of PDB 2qhb Chain B Binding Site BS01

Receptor Information
>2qhb Chain B (length=85) Species: 35889 (Nicotiana glutinosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RIRRPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWK
TLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qhb Complex structure of plant telomere bindig protein, NgTRF and telomere DNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R601 Y616 K620 K624
Binding residue
(residue number reindexed from 1)		R27 Y42 K46 K50
Enzymatic activity
Enzyme Commision number ?
External links