Structure of PDB 2qbx Chain B Binding Site BS01

Receptor Information
>2qbx Chain B (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQVCNVFESSQ
NNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEAD
FDSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPV
SRSGFYLAFQDYGGCMSLIAVRVFYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2qbx Three-dimensional structure of the EphB2 receptor in complex with an antagonistic peptide reveals a novel mode of inhibition.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
E52 Q68 C70 N71 S101 V102 R103 D104 S107 R163 V164 M165 K166 M193
Binding residue
(residue number reindexed from 1)
E25 Q41 C43 N44 S74 V75 R76 D77 S80 R136 V137 M138 K139 M166
Enzymatic activity
Enzyme Commision number 2.7.10.1: receptor protein-tyrosine kinase.
External links
PDB RCSB:2qbx, PDBe:2qbx, PDBj:2qbx
PDBsum2qbx
PubMed17897949
UniProtP29323|EPHB2_HUMAN Ephrin type-B receptor 2 (Gene Name=EPHB2)

[Back to BioLiP]