Structure of PDB 2q2k Chain B Binding Site BS01

Receptor Information
>2q2k Chain B (length=44) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2q2k Segrosome structure revealed by a complex of ParR with centromere DNA.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		L9 K11
Binding residue
(residue number reindexed from 1)		L6 K8
Binding affinityPDBbind-CN: Kd=17.5nM
Enzymatic activity
Enzyme Commision number ?
External links