Structure of PDB 2pv9 Chain B Binding Site BS01

Receptor Information

>2pv9 Chain B (length=258) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPW
DKNFTENDLLVRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDI
ALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETWTT
NINEIQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDA
CEGDAGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFYTHVFRLKRWI
QKVIDQFG

Ligand information

>2pv9 Chain C (length=26) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KSSDKPNPRGYPGKFCANDSDTLELP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2pv9 Crystal structures of murine thrombin in complex with the extracellular fragments of murine protease-activated receptors PAR3 and PAR4.
Resolution	3.5 Å
Binding residue (original residue number in PDB)	L40 H57 W60D R97 W148 T149A I174 D189 A190 E192 G193 A195 S214 W215 G216
Binding residue (residue number reindexed from 1)	L26 H43 W50 R93 W148 T150 I179 D199 A200 E202 G203 A205 S226 W227 G228

Enzymatic activity

Catalytic site (original residue number in PDB)	H57 D102 E192 G193 D194 A195 G196
Catalytic site (residue number reindexed from 1)	H43 D99 E202 G203 D204 A205 G206
Enzyme Commision number	3.4.21.5: thrombin.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0006508	proteolysis
GO:0007596	blood coagulation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:2pv9, PDBe:2pv9, PDBj:2pv9
PDBsum	2pv9
PubMed	17606903
UniProt	P19221\|THRB_MOUSE Prothrombin (Gene Name=F2)

[Back to BioLiP]