Structure of PDB 2puy Chain B Binding Site BS01

Receptor Information
>2puy Chain B (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMIHEDFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQ
DQMLKKEEAI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2puy Recognition of unmethylated histone H3 lysine 4 links BHC80 to LSD1-mediated gene repression.
Resolution1.43 Å
Binding residue
(original residue number in PDB)		E488 D489 F490 S497 G498 Q499 L500 M502 I522 P523 K524 G525
Binding residue
(residue number reindexed from 1)		E5 D6 F7 S14 G15 Q16 L17 M19 I39 P40 K41 G42
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2puy, PDBe:2puy, PDBj:2puy
PDBsum2puy
PubMed17687328
UniProtQ96BD5|PF21A_HUMAN PHD finger protein 21A (Gene Name=PHF21A)

[Back to BioLiP]